DPCstruct | MC48859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6L6S3 | 1-128 | MVKMGRDIFPHDFLGDVYYITAIKPWDKKAAGDAAVKTMLVDGVKRLDQDAHDRFKVAYMDVPWEVDRVTLLQGIEHTDFFSKIRAD… |
| A0A5J5IXT8 | 5-141 | SVDDALLRTATRVARLSFPHDVPGDVYATAAADALAEVSADPLIEARIQRALRWAVERDPCNDQLLAWLTDHSDEDWFRTFRQLVIP… |
| A0A5B8M6R8 | 5-154 | None |
| A0A2D7TLY2 | 23-168 | None |
| A0A4Y1N1N0 | 12-155 | None |
| A0A345JUG0 | 11-145 | None |
| A0A7G5IIA4 | 12-141 | None |
| A0A836X2P2 | 27-174 | None |
| A0A7D3XG26 | 20-182 | None |
| A0A521WA16 | 23-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.