DPCstruct | MC48853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 255 ± 51 aa |
| Standard deviation of domain lengths | 50.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 99.63 |
| Assigned Pfam label(s) | PF06985- PF09362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IX96 | 6-244 | FGFSMDYASTQKSTCSSCTVTKDLSNYWTPTLFYQAQNGSFIPVTQNGGVTVYYLQRSDPLDPEYANGLLAFPEGFRMVAGNPYLRS… |
| A0A7K1J1A2 | 4-165 | LDNGQLITPVKSVAYYRAGVGVDPTTVVAFPPGLMMIAGDPMATEAQPTSVVAWSCGSGGMREELPPSCPDDRGLRIDITFPDCWDG… |
| A0A5N0UQR7 | 140-346 | None |
| A0A2D8F847 | 77-344 | None |
| A0A0M9VUW5 | 22-316 | None |
| A0A2P4YMR6 | 7-282 | None |
| A0A6G1HS81 | 6-238 | None |
| Y0KIC6 | 326-582 | None |
| A0A0D0TW39 | 209-522 | None |
| Q2GX37 | 1-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.