DPCstruct | MC48851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 332 ± 55 aa |
| Standard deviation of domain lengths | 54.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 76.47 |
| Assigned Pfam label(s) | CL0123- PF13907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IVB0 | 8-370 | LVKEARLVGRDEDLMKATLKALTEESSRRLKEENERVDALERAANKPLTKKDRKAVLFDYSGVKRVNAETIMERPGEMRMLRTVLEN… |
| A0A7S2Z7V7 | 3-274 | PTLGFFGNAIRVKETKNRLVELRAVDEMVGKMDDLGKFRIGGAMLPRAPVWARKCQWTPKDDAMILVGIYKHGFGSWDKMLGDEALG… |
| A0A178VS84 | 53-349 | None |
| A0A835RGU4 | 223-522 | None |
| A0A3P7FA82 | 811-1221 | None |
| S9XNG0 | 569-847 | None |
| A0A164MZU9 | 1-331 | None |
| A0A5B0Q3W7 | 461-852 | None |
| A0A0B2W090 | 322-672 | None |
| A0A0P0XA01 | 69-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.