DPCstruct | MC4885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 168 ± 12 aa |
| Standard deviation of domain lengths | 12.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9F330 | 116-263 | DHHKKLRSFIKEYLPEMATILQRLQKENPEEFEETIDNLYEDMEELEELKRENPDMFALAVRAQRHSIRSEILADRYRETKDEALKK… |
| A0A525DCF1 | 17-168 | GDQVLDWLKTRVPQAHTELMELKKDSPDEFTEQIHDIGGQIEYIESLRETNPQMADQLIAVENMEYKSWEVAQSIEESKNEAKRNEL… |
| A0A2E2B177 | 64-235 | None |
| A0A7V5EAS2 | 198-364 | None |
| A0A3N9NWU3 | 37-206 | None |
| A0A7T4YJA1 | 139-304 | None |
| A0A517YQ19 | 64-254 | None |
| A0A7X0H966 | 1-155 | None |
| A0A6P2AMZ4 | 63-247 | None |
| A0A6L3A8R3 | 41-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.