DPCstruct | MC48847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2LA92 | 55-152 | GDTSFYGTSMTVDTTKVFSVVTQFITSDGTDSGDLTEIRRYYVQNGVVIPNSYTNFVQIGKTNAVTSQFCTEQKTLFGDPNDFDAKG… |
| A0A2G7G1I6 | 837-927 | GAKDYYGYGLKVNTNETFTVVTQFLTSDNTTSGQLSEIRRLYIQNGQVIQNAAVTSGGKTVDSITKDFCSGEGSAFNRLGGLEEMGH… |
| A0A0C9T8V6 | 47-127 | None |
| A0A812MDT4 | 1069-1160 | None |
| A0A0G4N2D1 | 55-142 | None |
| A0A4Y8DHQ4 | 90-186 | None |
| A0A6A3TWP6 | 61-160 | None |
| A0A4S8MEI0 | 21-102 | None |
| A0A146HBA1 | 817-895 | None |
| W2PID8 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.