DPCstruct | MC48846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 208 |
|---|---|
| Mean domain length (aa) | 299 ± 75 aa |
| Standard deviation of domain lengths | 75.05 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0023- PF17763- PF01237- CL0266- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IJD1 | 7-274 | EKIAPQHKSAWFGFIKSVATFKGDLSTLTAPPFLLSPQSIVEFPTYWAEHPSFTLKWQHSTRDENGKKKGMKPLNPFLGECFMGSWE… |
| A0A0C4E4P1 | 3-213 | EQLEYAHLLDSAARQKQARDRLLYVTAFAVSQFSSVRARERAIRKPFNPLLGETFELLRAEPEVPGGLRLLVEKVSHRPVRLALHAD… |
| A0A4Q2D557 | 1-251 | None |
| A0A7C3KKD5 | 7-208 | None |
| A0A090KZF9 | 338-647 | None |
| A0A498LPU9 | 510-889 | None |
| A0A7R9TX15 | 96-314 | None |
| A0A267GH48 | 475-833 | None |
| A0A369RYD4 | 746-1045 | None |
| A0A369JGA0 | 256-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.