DPCstruct | MC48844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 170 ± 29 aa |
| Standard deviation of domain lengths | 29.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IE30 | 7-178 | LLSPLIFLTTFSRIINVNASFNLNTSSPDWDYVAKDLANTTCKACIAAYSTDIDCDATLLGLVASMRPAFRPTSTDFDNTCTTTCSD… |
| A0A1B8B0H7 | 163-322 | YQADDVLEFEVSSACQTALTRRVLCDSQVDEFAERRYRGALESRNRTDSVCDAGCGESLRSWYEAVVTACKGYTLDEAVPMLLGGNM… |
| X0ARF6 | 9-160 | None |
| A0A1L7VFE7 | 5-173 | None |
| C1H9L9 | 3-209 | None |
| D4D835 | 1-157 | None |
| R1G8C4 | 7-102 | None |
| A0A365NBB3 | 1-211 | None |
| A0A6G1I496 | 1-151 | None |
| A0A2B7XFV4 | 6-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.