DPCstruct | MC4884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0UP43 | 263-355 | TRKVADCGAFDMEDLDGGFLLKVVANMKRDPEAKVRFGTSGNGFTPNYVISYGDGRTVCFAGCNHQTMPKGKMFSEKNLSGFFSRLD… |
| A0A525D8B4 | 92-181 | SSIEWDESRVAHLSINYLQKVFTNMGDDGDKVFFSTSGKGIRPSYQIEFKNHDLAAFNGAAHSPLKKTFPPESDLISQPFTQGFIRS… |
| A0A2N5EAN7 | 1-93 | None |
| A0A127P4W0 | 1-94 | None |
| A0A853FW44 | 1-94 | None |
| J3HVH6 | 64-153 | None |
| A0A158EIX3 | 10-93 | None |
| A0A158EFA0 | 3-99 | None |
| A0A155ZV38 | 9-104 | None |
| A0A4Q3LWA1 | 4-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.