DPCstruct | MC48837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11962 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329LWY3 | 221-341 | GSYNKPMAGSATMFNSSADAFVIGNGSSSSRSNAFRVAFNGNVYGLSAFNSSGADYAEYFEWQDGNPNNEDRTGLFVTLDGDKIRKA… |
| A0A239LEM1 | 1-104 | MGRNGAVNATDGGPTYSWNVAFGAVAYDVTGLVGKLLNNGNMFVDGAYLTPAGDYAEMFETADGNSIDVGYFVTVSTEDKIQKAASN… |
| A0A3E2NA39 | 181-280 | None |
| G9QAB1 | 104-246 | None |
| A0A132C4R7 | 89-222 | None |
| A0A1G9QNR0 | 306-406 | None |
| A0A1I6RZE0 | 339-462 | None |
| J8FY13 | 1-112 | None |
| A0A5Q2NKX6 | 464-562 | None |
| A0A248TH06 | 586-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.