DPCstruct | MC4883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356DW54 | 3-77 | LSYRMLNIEGVPAGLLGLEELFSRLFDEDVAPDAPETPGLILEGVKEHNFVPKSATQSYITTLQQEYQRYYRKRK |
| A0A1V5B9E1 | 18-95 | GCGCCGTRIVGVRQINVGGSNVGISGMDETFQDYFNKGKKPGDLTGDELVEDLKKLNFIADGAEEMYKRAFLEEYKRY |
| L0KUM2 | 48-143 | None |
| A0A348ZW54 | 39-118 | None |
| A0A7V3K5V3 | 7-88 | None |
| A0A1F4UEM7 | 2-69 | None |
| A0A1F8PRI0 | 55-133 | None |
| A0A349A102 | 1-94 | None |
| A0A6J4YG70 | 1-75 | None |
| A0A7L4PT81 | 5-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.