DPCstruct | MC48826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 581 ± 72 aa |
| Standard deviation of domain lengths | 72.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6X372 | 102-672 | APAELLVCSMKLIESYRKKREPGQTPNVYADIWLPLYNVVHPYDIQTMKQILFGCVRYERLLRIFLDRMYEQISTLTFDDEMKYTVL… |
| A0A0D2K4E7 | 11-569 | RVMGPRELIDACCWVWDTHDAARLSLDAHIESCLAQRGGGGGEDTDDATFIAQVVYGLHRYRRLLSGFLDGFFHAKSGKALRTDATR… |
| A0A814VY97 | 6-610 | None |
| A0A814D3N5 | 7-630 | None |
| A0A177AWA2 | 141-639 | None |
| A0A5C6NX96 | 29-655 | None |
| A0A3P9J2P1 | 1-605 | None |
| A0A0V0QQZ9 | 17-579 | None |
| C1ECX0 | 15-772 | None |
| A0A3Q0KRI8 | 5-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.