DPCstruct | MC48822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 448 ± 67 aa |
| Standard deviation of domain lengths | 66.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0GP04 | 111-594 | ESNPTKESLTNQEPPLSILEKSQLEKQKKLESERLAKAEKERAQKIKDKEEAELREKIRAQKNATLGKSELDRKIAKREKIPYEELE… |
| A0A1V6E870 | 59-554 | AGRGTKRAAGAVARKVRKNPTGTGAAAVGERGGWSIVKPEKRDDAGGVLAWGPSGMLEDSEGRLYPFRWALVPLSRIIPSNDPKTGR… |
| A0A2G6EQW1 | 33-453 | None |
| A0A0E0WA94 | 283-649 | None |
| A0A2T6TPD9 | 217-748 | None |
| A0A293TEN7 | 498-979 | None |
| A0A1V3BEM7 | 183-779 | None |
| F8KQN1 | 359-793 | None |
| A0A2T6SFD5 | 211-833 | None |
| D7ICL6 | 298-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.