DPCstruct | MC4882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7W6K2 | 1-61 | MIKQFLPQQSGSAALEKATELFKQEAFRLRDLGKHSHIPDLLAFFPQEGRLYLIQEFIEGK |
| K9SRR8 | 59-117 | CVIKQFTYTGVGMQKASELFQQEVEQLEKLGKHAQIPELLAHTEQEGRQYLVQEFIDGQ |
| A0A1Z4HA74 | 59-121 | None |
| A0A844MHT2 | 35-99 | None |
| A0A6P0TCE2 | 10-71 | None |
| A0A0D6AMM0 | 295-363 | None |
| A0A0D6AE95 | 61-122 | None |
| Q10WN1 | 67-128 | None |
| A0A7C3VIA3 | 33-97 | None |
| A0A7X6HPW5 | 7-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.