DPCstruct | MC48818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 134 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 76.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3PV01 | 5-102 | SLFLLLSLLLGATVLYSQNPETNLRVVSVSPNAASLGTFGMIPTSNYVGQASLSIPVYEIDLDGKKFPITLSYHTDGTRVAQEATWV… |
| A0A3G6ND02 | 1-175 | MQAQHQFQGVNFGDTPNPVPSLSSLADLTDNPPSLALGIPEISVPLLSLSGYGGSRFGLQLSYNPTGVSPDDAAGEVGAGWSMFKGG… |
| A0A3C1RKG8 | 17-249 | None |
| A0A086F365 | 13-164 | None |
| A0A086F2H6 | 1-160 | None |
| A0A2N0XFI4 | 20-223 | None |
| A0A2N0XE54 | 24-212 | None |
| A0A2T2U7D5 | 1-123 | None |
| A0A4Q1D949 | 6-199 | None |
| A0A644ZGL6 | 5-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.