DPCstruct | MC48816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9N1A3 | 1-103 | MTKFKRWSMSYTSTRPQTMKKVASDLNDIRFMIDWLAEHGEQIRFVDYSGKTKLELLVMLRRYHDKYADDEEHIAVLCSIMSDDWDT… |
| A0A1L7VXX4 | 63-164 | SIPILHPSVLVLTKLKRSSQYIGSTRPQSVVKLYSDVRDIVYLLHWLQDHYMKIDFINYDSVTPERLYDAVRNMRAHWVSMGENDQV… |
| A0A5C2SX67 | 138-245 | None |
| A0A1C7LPH1 | 86-191 | None |
| A0A2A9N9D9 | 116-206 | None |
| A0A4Q2D6I1 | 100-197 | None |
| B0D6T9 | 21-118 | None |
| D8PVJ7 | 5-95 | None |
| A0A5N7C927 | 117-227 | None |
| A0A366R3J2 | 6-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.