DPCstruct | MC48812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453T555 | 1-86 | MDLEAVPVRKACTEMLKRATRQQRYRLKKEYFDPHAPHLVRRTSPVPSMTDDQWNELVESWKDPKKMVLGYLKLTKLIELKLSSTK |
| Q6ER40 | 300-372 | IDIHSDPVIAAMEDILRCGTRHMRYRLKKKYFDGVPANQVRTTSPLKCMTDEQWTKLVDMWSSPEHKDKCAKT |
| A0A811N9F5 | 54-114 | None |
| A0A1D6LLH6 | 49-114 | None |
| K3YM31 | 1-77 | None |
| T1NAB0 | 248-337 | None |
| A0A1D6G5P9 | 180-252 | None |
| A0A5J9WEF7 | 51-155 | None |
| A0A452YVE9 | 77-162 | None |
| A0A452YVA3 | 35-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.