DPCstruct | MC4881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.94 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0014- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MMV8 | 23-112 | HLSAMQAIAHGSDSVLYFQWRQGRGASEKFHGAVVDHSGHEHTRVFQEVADLGKQLEQLQPIAGTSVQPEVAIIYDWENHWAIDDAQ… |
| D9WTL9 | 7-93 | QALAHGADSVLYFQWRASRGGHERFHSAMLPHSGTGSRTWQEIEALGTELPRIAEAAGTTAHADIAVLFDWNAWWGLTETNGLPRND |
| A0A0R2A485 | 1-98 | None |
| A0A1C5FS45 | 4-81 | None |
| A0A3T0Y7L7 | 37-114 | None |
| A0A3S5IAU8 | 84-175 | None |
| A0A3S8S8W4 | 2-89 | None |
| R0B007 | 40-130 | None |
| A0A1Q6SLW4 | 81-170 | None |
| A0A0N1NB45 | 28-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.