DPCstruct | MC48801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 4 aa |
| Standard deviation of domain lengths | 3.81 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 72.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3NKC7 | 4-143 | RQELENLDQKAKSLSEFFYSYCKMKGDQSYTNVVRSVRDYLEKRISYKLVFQNLKLWDVEDFERKDDYHMIILNYRGYIIQRFTVNA… |
| A0A453SES9 | 1-134 | MIQQKVENLKISLEHFCNIKGDISEVLRVAEEQLKMRNQCRIINQQASLWELKDIVKRENKRDVILNYRNLLLQRIILNLSDMSTLF… |
| A0A4S8JNZ4 | 772-914 | None |
| A0A835VKA0 | 95-234 | None |
| A0A199US70 | 734-867 | None |
| A0A446XP30 | 636-774 | None |
| A0A1U8NN08 | 367-509 | None |
| A0A453SFQ2 | 59-195 | None |
| A0A178VW82 | 55-197 | None |
| A0A6P5XJ30 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.