DPCstruct | MC4880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8JRS7 | 131-217 | AVHRFDCTAEAYDASQGDGIHDGDLLVIPGEGIVAILTDAWPVALTTRNGELHKLTGPAHEIEDGRYAASVEKAMAQAAACGVDLDP |
| D9WPL7 | 87-172 | LTHRFEDTEEAYNATQCRDDIRDGDVLIIEREGVVGFLRSAWPAAITAEHGELHSVDGDPRTLDDGRYAASIEDAEQIAREHGFAL |
| A0A3D9QFZ9 | 54-150 | None |
| A0A0N1H0Z9 | 125-225 | None |
| A0A0F9UCF1 | 275-368 | None |
| A0A0M8WX62 | 117-206 | None |
| A0A7I8C2W1 | 6-119 | None |
| A0A2N3ZTF8 | 72-168 | None |
| A0A429DNG9 | 2-96 | None |
| A0A7X5X935 | 6-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.