DPCstruct | MC488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5USZ5 | 1-87 | MGDWLGTGTVAPRLRKYRLFTEARAFAHGLKLKSRNEWSRYCKAEVPNLTKLPEDIPAKPDNTYKNLGWKGTRDWLGTTNVEDKTKM |
| A0A081RKY0 | 62-127 | TIAPQNKKFRSFKQARRFARKLKLNSYFAWVQYYKTNALPTDIPTTPNRTYKNKGWKGWNDWLGTK |
| A0A830H9W6 | 30-99 | None |
| A0A830HD14 | 30-99 | None |
| A0A830HEH5 | 325-395 | None |
| A0A830HFJ9 | 379-452 | None |
| A0A830HNT2 | 94-164 | None |
| A0A830HQN3 | 517-586 | None |
| A0A830I058 | 115-184 | None |
| A0A830HU18 | 127-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.