DPCstruct | MC4879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.36 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF01654- PF02322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848QCE1 | 2-150 | FDYATLRVIWWALLGTLLIGFAIMDGFDFGVAGLLKVLGRDNEERKVLLEGIEPTWEGNQVWFILAGGATFAAWPTLYAVSFSGMYF… |
| D9W8Q2 | 3-149 | LHDFWFLLIAFLWTGYFFLEGFDFGIGVLTKLLARDRTERRVLINTIGPVWDGNEVWLITAAGATFAAFPDWYATLFSGFYLPLLAI… |
| A0A7C5AXT7 | 1-167 | None |
| A0A5S9MMG0 | 74-212 | None |
| A0A1V3WI67 | 2-121 | None |
| D1NY01 | 3-139 | None |
| V4XMA1 | 12-147 | None |
| A0A378B3V6 | 3-146 | None |
| A0A378LQ48 | 464-605 | None |
| A0A1V2EX11 | 5-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.