DPCstruct | MC48787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5MQI5 | 1-114 | MEKAEVVQALREALNEALGIEPVEIGAKWKGGEMILQPANPSLKPQRLPVETFFHKIVMVRDKLRLLEAKINAHPKLDDAEKVEFQQ… |
| A0A1G1GC47 | 47-162 | QSLSEPERTAYEMVKLAAFEVNREELPKTPLGSRWQGGEMILKPGDSKLAAKSLPIETFFHKIVMVRDRLRVMEAQINGHKALTDTQ… |
| A0A7Y5GUV7 | 122-251 | None |
| A0A534PE28 | 89-217 | None |
| A0A1Y6BQC0 | 1-113 | None |
| A0A7W1P564 | 65-201 | None |
| A0A2F0AQJ0 | 142-254 | None |
| A0A1V6DPU3 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.