DPCstruct | MC48783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 174 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416CAI7 | 69-250 | LAMIVKFVKYLIDKDVLDKQYEEDSIYGLTIMLEKIVAYVVLFCIAFIVRKPIDGIIFTVSFMAVRQTTGGFHAKSFLGCLTGSVLT… |
| Q88S59 | 10-186 | LYKLSDRLFAAIQKNLQLERRQALLVKLGIDTVLNVIPKLIITIILALLLHELVPVLVFMGSFLVLRGFAYGRHLESDLLCTILTAV… |
| A0A351QTA6 | 2-187 | None |
| A0A7G6DYJ3 | 4-199 | None |
| A0A3R6TI95 | 5-191 | None |
| A0A413RVR9 | 5-191 | None |
| A0A173VM65 | 4-182 | None |
| A0A345FQA8 | 2-181 | None |
| A0A416FIH8 | 8-165 | None |
| A0A1R1BAL0 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.