DPCstruct | MC48782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7JK30 | 1-149 | MDISVRKQTHRGRKDNSEDNISHIWDRMRGRNDAYYYQINRNSPLCKYVMEHIPDDAADIVETLLSEIEKGIPVQDIYVDRCNDAIV… |
| A0A284VMB3 | 2-119 | GKKIRHGKIFYSLNRQHPLIKEVLENSDEHNPAITALIRLIEETVPVPLIAMDNSENPDKQIKPFDKLPSQELIEVMTEVYKSLLAS… |
| A0A6I7M6S6 | 97-240 | None |
| A0A843DSB6 | 46-175 | None |
| A0A1J5S5D2 | 181-301 | None |
| A0A1H9CU33 | 141-268 | None |
| W8YXA8 | 3-134 | None |
| A0A2T0RNK9 | 501-618 | None |
| A0A318KL41 | 1-144 | None |
| A0A6Y1FTR5 | 59-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.