DPCstruct | MC4878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832GQN3 | 2-90 | EAVDEGFLALGDSIRQAIYWHLENRFSIKQNEIPNKLKEFMEALKNMFGSGAEILLKIIIKRFYIKLNLKFKDVEGWSFIDYIENAK… |
| A0A3R7IDD7 | 5-103 | NLNDIILAAVEDGLSSLGDSPKQAIIFHLETSFHIKKEYIPENLTEFTKALEGIFGPGASYLEKLILKHLYGKLGLKFEEKSWNFQE… |
| A0A497MVL8 | 2-114 | None |
| A0A497MVF0 | 16-119 | None |
| X0YNQ4 | 13-122 | None |
| A0A7J3ADK4 | 71-176 | None |
| A0A7J3QTJ3 | 2-117 | None |
| A0A523VQR4 | 9-88 | None |
| A0A2R6C059 | 6-96 | None |
| A0A497P6L6 | 6-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.