DPCstruct | MC48779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 20.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0475- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6BCL8 | 345-478 | AYKNDIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIRRMNCKAVFAKSTGMIILGGGLVKHHIANANLMRNGADFAVFVNTGQ… |
| A0A4S8IMD2 | 393-520 | ALTDGSLGDMLYCHSVRNPGLLIDIVQDIRAMNGEAIHVGLRKTGVIILGGGLPKHHICNANMFRNGADYAVYVNTAQEFDGSDSGA… |
| A0A832XFM6 | 1-78 | None |
| A0A4W6DZN1 | 87-209 | None |
| A0A251SV33 | 6-108 | None |
| A0A453DTV7 | 2-97 | None |
| A0A182FFE2 | 222-356 | None |
| A0A7W1T271 | 112-283 | None |
| A0A7C1EAZ1 | 196-325 | None |
| A0A7C6A8Q6 | 6-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.