DPCstruct | MC48773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8NAR9 | 2-133 | ITLNETQGSIEKLTFVNHTECHCVDKAKQRSALYEADEASSEIASNHIPYLRRATILNCNCPNLFEKILQEDGFCRCDCSSGNMGCD… |
| A0A0P4VQ96 | 137-221 | HNVVIHSCKCPRSYQPVSVDGQCTCDCDITRSRCRRYKKGRRYFSSADVRCVSTGECVAPNCEYGPFLAQQRRCTKRRERERYIT |
| A0A6J2YJL1 | 320-460 | None |
| A0A6G0U3B6 | 161-266 | None |
| A0A1J1J905 | 316-425 | None |
| E2B0D0 | 6-111 | None |
| U4UMH8 | 196-310 | None |
| A0A182F4F3 | 148-247 | None |
| A0A7M7K0D8 | 227-324 | None |
| A0A834MXT9 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.