DPCstruct | MC48762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 59.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059CCH5 | 72-129 | RPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEISVK |
| A0A1B2I492 | 6-57 | AEYYFTAIVGQEDMKKALILNVVNPSLGGVLIRGEKGTAKSTAVRALAQLYV |
| A0A1V3XTM6 | 1-53 | None |
| A0A6A6LQB3 | 66-120 | None |
| W4TWM5 | 2-54 | None |
| A0A165ZMN7 | 3-57 | None |
| U2T4M0 | 1-62 | None |
| A0A0F6MQH4 | 3-59 | None |
| A0A2J8AG70 | 72-129 | None |
| A0A7R9R8A8 | 5-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.