DPCstruct | MC48758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3XCT3 | 1-95 | MSVGLSDDDALFSCSVWRPSGKSYLFFTQFKIELKGAKIEYGNAYSQTAAAGQGDMPLNPEEFSVGDSTVTHRDGKFRAQLAKVTAV… |
| A0A485MHZ8 | 147-243 | WQMSLGTSKDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYGMAYSKAAFERESDVPLKNEEFEVTKTAVSHRPGAFKAELSKLV… |
| A0A812AXZ2 | 201-288 | None |
| A0A3B3I8N3 | 41-135 | None |
| A0A662YPS5 | 567-663 | None |
| A0A7S2XAF0 | 13-117 | None |
| A0A5C6MWX5 | 657-753 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.