DPCstruct | MC48757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068YD18 | 10-133 | IEAERYLDEKRIPELLHNLSSLVVFNRPENPIEYMISILEKLKAAQHGRGENPFIFTLANAESIFHMLDPNMRGYVTFEQYKHGLET… |
| A0A3Q3X7A9 | 7-113 | EDAVEYMRRHQVPELLENLSSMLFFCRPENPREFLLQQLEGGGVRGPHLFTSTNLDAVFRILDPSDQKYISFAQYKHALSTLGVRDI… |
| A0A388KNN0 | 76-213 | None |
| A0A5B8MJK0 | 3-140 | None |
| A0A817KY33 | 64-179 | None |
| A0A1S8VXU2 | 23-143 | None |
| A0A7S1KPF3 | 220-366 | None |
| A0A1V9ZHC5 | 380-512 | None |
| A0A814QPB9 | 71-184 | None |
| A0A6S7HX58 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.