DPCstruct | MC48755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 46.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3WKF4 | 15-118 | SSSSSDRKHRDASAVLPFIGLTGSSEQSRSCCKNGGTCILGSFCACPPFFSGRSCQYDQRNRSCGMITHGEWVQKGCSYCRCGYGIL… |
| A0A670JGP5 | 42-117 | KVNRQCCQNGGTCFLGTFCICPKHFTGRHCEYDTRIRSCGTIKHEEWIQEGCQLCQCYYGTLKCSAQALKQGCGKK |
| A0A2Y9RZW4 | 107-239 | None |
| A0A671TV06 | 29-111 | None |
| A0A1S3GAF5 | 10-109 | None |
| V9L7Z7 | 61-161 | None |
| A0A671E0F7 | 64-172 | None |
| A0A674JFW1 | 1-111 | None |
| A0A673ANT1 | 60-144 | None |
| A0A6P9BGP6 | 67-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.