DPCstruct | MC48754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SSR1 | 186-276 | PQSAYIYPLLDTLMEFNGSAPYSVITKQVYEKMKHIFNSYDLSPVTHNKYIPRWKDTLKWIKIDLVNRGILEKNTERGIWTITEYGK… |
| A0A514EWR2 | 1-102 | MPFPSYKEIEIPLLLNIYNGGGEVSSSSCYEPLGKEFGLTNEEMNMLLPDDTNRPQWNNMVQWARKKLVDYKYLHNAKESGLGIWKL… |
| A0A498B308 | 111-206 | None |
| A0A444K6V5 | 12-121 | None |
| A0A806CIU1 | 188-289 | None |
| A0A838QLB9 | 3-114 | None |
| A0A2N0F063 | 8-105 | None |
| A0A5E4KPH1 | 9-111 | None |
| A0A354C048 | 1-77 | None |
| A0A7C5QYQ0 | 381-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.