DPCstruct | MC48753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A514EVJ9 | 1-109 | MVAQAGASHEAPVSNVAGYANPVWATTSEIGVSGGSSHMQTLEAAIMATILAPSHPQFVFVFAAVRRADRKPRICMLRAVAGDEHAA… |
| A0A3G5KBV8 | 204-286 | AKPGSALTLTGPLTTNDSQRIEAAMLNHTPTRFKFLFLAVRRSDLNAKPHRESVTAHSEQDARRSLAGQFVLSFAGRLPEVTH |
| A0A0T9R5Z7 | 1-88 | None |
| A0A515D2S1 | 236-330 | None |
| A0A8B2U2B4 | 1-100 | None |
| A0A4S2PRI8 | 52-149 | None |
| A0A1B9KI36 | 77-184 | None |
| A0A1B9JMT9 | 1-116 | None |
| A0A898GZ46 | 30-173 | None |
| A0A1X7M6T4 | 61-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.