DPCstruct | MC48750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 238 ± 40 aa |
| Standard deviation of domain lengths | 39.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0020- PF04871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023FH59 | 3-224 | SVTAGQLLCGGLFSTDPLSNWFAAVALSHALVDNPTQKEQLLRVQLATSVGNPPVSLMRQCTGILQQGGKLQTRLGLLMLMSTWLAN… |
| A0A821SYI0 | 3-211 | HTLGSLLINGYVSNDVVASWCSSSGFSCLIGGHFDKTHKEEMLKMVISIDQSSINGKTLMELSTDLLKNTSSSFHTCVGILVFLYTW… |
| A0A1Z5L0I5 | 90-337 | None |
| A0A3P8GSZ9 | 1-191 | None |
| A0A5J4NC91 | 9-209 | None |
| A0A7R9A8D7 | 339-671 | None |
| A0A7J7GE27 | 201-427 | None |
| A0A7R9D3Y0 | 3-190 | None |
| A0A7J6W8Z8 | 51-295 | None |
| A0A5N5QQB7 | 685-995 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.