DPCstruct | MC4875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5AXQ6 | 1-103 | MHKENPYKTDFSVAEIVDRVAEENIFGRLRPGVIVHVNLHCVANKRPNPANYRTLYETARGRRRLFKAGDNFHPYREGGKTHPLPEE… |
| A0A3R7BP50 | 101-217 | IKVADEVWIACALLHKENPNRRDFSTREIIEKVREENIYGTLRPGVYVHVTQHCIANKKPNPGKYRMLFETEPGRRRLFKKGDPYHP… |
| A0A523DHI7 | 2-104 | None |
| A0A2V8UBD4 | 19-137 | None |
| A0A2V9R156 | 4-121 | None |
| A0A1V5YH35 | 204-310 | None |
| Q67M20 | 39-159 | None |
| A0A2G2LLX5 | 1-123 | None |
| A0A2A3TB48 | 1-123 | None |
| A0A6N8Y8X6 | 5-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.