DPCstruct | MC48745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821QCZ8 | 1-75 | MSWEMQLNESLLEELYEWIDSLSLSRPKKIIERDFSDGILVAEIIHYYLPEFIDLNNYNAANSLEHKKLNWLIEY |
| G4YHY3 | 3-71 | SVYVWVSQFAFSRPMKNPPRDFSDAVLLAEILAQLVPAWVQLHNYPSTLRFQQKLSNWETLNRKVLTRL |
| A0A667G2P6 | 1-92 | None |
| H3GCM0 | 603-683 | None |
| A0A2R7W4K2 | 26-116 | None |
| A0A182JK29 | 1-86 | None |
| A0A822E2K1 | 1-77 | None |
| A0A818WCL0 | 1-76 | None |
| U6KB70 | 31-113 | None |
| A0A671ELC5 | 8-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.