DPCstruct | MC48743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 247 ± 42 aa |
| Standard deviation of domain lengths | 41.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178F1Q7 | 36-277 | NNFDVNIQATDNYGYDAHGMPSNTTDLSHIDQQLLQAVGNQNGVSDDNAMTAKAALAAHQPESKYPPPEPSFDNNGLGNNLSFGQDV… |
| A0A642URM6 | 29-215 | DSELLQQQSSYHQHKDDLRDSPTEDSAVAAAVAAVNADPHHHSAQQMQQLQFYRQQQHQQQQQHTFAPTTLPSKPSHGSDEWHRQRR… |
| R9PB22 | 1-327 | None |
| I2H3C0 | 69-441 | None |
| A0A0F4GI90 | 268-467 | None |
| A0A0C9ZI43 | 1-217 | None |
| A0A1E3PRL3 | 166-414 | None |
| A0A7D9H1C0 | 30-264 | None |
| A0A507F9H6 | 24-311 | None |
| A0A197JT57 | 73-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.