DPCstruct | MC48740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084WIW5 | 83-151 | ELLFCIESSDDPAVEVVNRLCNKYPNIEAKLLVGGSNVGVNPKINNLYPGYVEARHELIMISDAGIRMK |
| A0A1B0C4E5 | 1-72 | YELLFCVEDKTDPAIQLVESLTAKYPQVEASIFLGGSNVGVNPKINNMHPGYEAAKYELVMISDSGIKSKYV |
| A0A0V0X4E4 | 89-157 | None |
| A0A6V7W9L8 | 54-136 | None |
| A0A5B0R697 | 7-90 | None |
| A0A5B0QYM2 | 1-80 | None |
| A0A016SV66 | 101-168 | None |
| S4R7J1 | 83-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.