DPCstruct | MC48738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 179 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.99 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF09070- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9C8P9 | 2-167 | KDDPWLTAHNFLQKNELSPMFLDQVANFIIENTKGHTLGAAPPSAADPFTGSGRYIPGAADNRAGFGADPFTGEGAYSSTASRQTST… |
| A0A0L9VSQ8 | 4-182 | DNPYDVADKWLLKENLPLSFREQVVQFILQNTGQNNVTFNASFRDPYTGSHAYVPGQPSHLSDISAKPTFKHIPKKGMLVFDAARFD… |
| A0A177WZZ5 | 909-1089 | None |
| B8BZP4 | 492-663 | None |
| A0A086QHZ1 | 38-215 | None |
| B9FVA6 | 336-501 | None |
| A0A3P8BJZ1 | 66-233 | None |
| A0A287I648 | 217-393 | None |
| A0A443N1F3 | 447-622 | None |
| A0A1I8F881 | 25-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.