DPCstruct | MC48735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7PNS3 | 137-208 | YNPGSAGQRRGTVNADGGTYTIYESTRTNAPSVEGTRTFQQYWSVRNSKRSSGTIDTGTHFDAWEAAGMPLG |
| A0A2S7PVP4 | 448-521 | SAAKKIGSVTSDGSTYDILTTTRTNQPSILGTSTFQQYWSVRTSKRTSGTVTTANHFNAWKKLGLSLGTHNYQI |
| A0A2S8RES0 | 131-197 | None |
| A0A4U0UXL2 | 489-567 | None |
| A0A3N6CN46 | 38-111 | None |
| A0A0K8LJ42 | 127-202 | None |
| A0A2K0TWS9 | 138-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.