DPCstruct | MC48730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381R5B2 | 43-102 | SFMTIDKLFDFIESKLDEEPEFHEIEYNKEYGYPESLYFDMSKMIADEEIGYLITNFKII |
| A0A538PRE0 | 1-59 | MRTIDGVFDDIQQAIDQHAAQIQLSFDPTLGYPTAVFVDHSHQIVDEELALQLSGLTTL |
| A0A1Y1QBY7 | 2-73 | None |
| A0A7C3D2P0 | 65-114 | None |
| A0A2E5G4N1 | 36-93 | None |
| A0A7R9ZQ60 | 3-68 | None |
| A0A2V8J6C7 | 44-100 | None |
| A0A2D8KCM0 | 31-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.