DPCstruct | MC4873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 30 aa |
| Standard deviation of domain lengths | 30.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H0CFQ5 | 2-259 | FAYFGVVDLWRRLRRDRDPAVRRRARFEFAHWRVQTGDAYTLLCASSRLTAAGREFTAMMAESAAHWTGQESVPDDLALLAREAVIA… |
| A0A0A6XG11 | 240-452 | PAFGVLHGAYAYLAVTRFRRSAPGAAAAFEFARWRGAVAEAAEALLTGGELTPAGTRFVTALRDEVTPWLDEPVDPAIQRLADLANA… |
| A0A810MEH5 | 2-154 | None |
| A0A0M8TTD0 | 1-243 | None |
| A0A1V2ICR5 | 268-520 | None |
| A0A4Y8MDZ7 | 483-763 | None |
| A0A6N7HLG3 | 33-286 | None |
| D3D590 | 193-436 | None |
| A0A429RZF6 | 62-300 | None |
| A0A6I8LFS1 | 190-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.