DPCstruct | MC48727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849F011 | 312-403 | KSYGNKKITVDSERLQKDIDSGKLKDVEIIEQDKIGDKLQKKIDQAQTKYDNNPSKKNSKLLERRKMDLKNTQRDKEILIKGKVLKK… |
| A0A2V4P7E2 | 1-81 | MDVKRLQRDIDSGALPDTKFLTNQQVTAELQSKLDAARARYTRNPSENNSDSLINAERDLGNAKRAGECLIMGCVPTDYIK |
| A0A1V3I6M4 | 459-554 | None |
| F0IPI9 | 175-271 | None |
| A0A4Z0QD74 | 347-443 | None |
| R8QJ44 | 37-115 | None |
| A0A428AFK2 | 561-657 | None |
| A0A7Y7XVC4 | 2-79 | None |
| A0A0A2ZPT6 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.