DPCstruct | MC48724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 27.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2DDM6 | 26-188 | NDPAGPPSYHTNSSSSGPELHIVSVYETRSDHSFGDHPQGTANVHIVNGGSAPITLVLSSYEPTLWNFSIDSGVVIDQVILNGYHDQ… |
| A0A7Y6PJS0 | 2-120 | EVHVIGVSDGGGDSEVVLARPGHHILVLSAYEPTTWHVSTKNGAKLDRIYAVGHNRQKVVTSATTKITLESAADGGADATGYVYPDK… |
| T1F2C1 | 7-188 | None |
| A0A534ZX93 | 1-109 | None |
| A0A1G3HEF2 | 477-632 | None |
| B8IDA8 | 22-274 | None |
| A0A1I2KIN6 | 10-144 | None |
| A0A3C1RVS2 | 175-339 | None |
| A0A7M7HL36 | 34-217 | None |
| G1KY55 | 75-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.