DPCstruct | MC48720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 12 aa |
| Standard deviation of domain lengths | 12.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9AS65 | 1-157 | MKKYTERYIYAVTKRLPVSMRTEVAEELKANIQDMIGSENPSDEVILTTLRKLGHPRVLANQYRGKERYVVAPEYYDDYIGTLKVVG… |
| A0A848RSU9 | 1-168 | MSTKATNEYIAAVARRVPQRKRNDVEAELRALIADEIDARLEAGEPEAEAERAVLRELGEPGVLAERYSPGSRVLLSRHVFRAWART… |
| D2AYC6 | 1-161 | None |
| A0A7Y7C960 | 7-158 | None |
| A0A2T0KI41 | 7-155 | None |
| A0A525KXD3 | 1-192 | None |
| A0A1H7GNV7 | 10-164 | None |
| F4QGT6 | 5-149 | None |
| A0A2N8MKX0 | 2-156 | None |
| A0A356L509 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.