DPCstruct | MC48711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6JH13 | 1-113 | MVEKSKEIASLKDFDELYELVRPIKDRIHGVGPLLHYDVCLRIATGFLEVKPELIYVHAGAKEGARALGLNTSNGKLKKDDFPAEVK… |
| A0A517T1Y6 | 131-231 | YDLESCETFHELFVMVHEAIASISGIGELMVYDTAHRLGAYLQLKPEYVYLHAGVRVGATALGYKPSTKWIEPTSLPKPFQKLTAGE… |
| A0A426TWM4 | 77-197 | None |
| A0A2V9HR89 | 5-103 | None |
| A0A1T4NJ08 | 84-184 | None |
| A0A4R6T8W6 | 107-216 | None |
| A0A1B9AGD4 | 1-89 | None |
| D4WIG3 | 175-269 | None |
| A0A2E2FHP4 | 80-190 | None |
| A1BGJ4 | 140-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.