DPCstruct | MC48709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 151 ± 34 aa |
| Standard deviation of domain lengths | 34.11 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 68.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 95.41 |
| Assigned Pfam label(s) | PF07500- PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9M882 | 3-128 | VEQEVAKLAKQLDKIVSEENSSQEVAVDLLKTLKDLPITLDVLQKTRIGMAVNVLRKSSTNPEVQTISKGLIKSWKKLLTDKESSKE… |
| A0A7S4QA38 | 3-143 | ASQQSLLAAVRSCTAQLTSASTGRGGAGEIIKALDQLAAAPMTVAILKSTHAARVVNREAILCHEDASVRKRGSELVARWRQLVRTT… |
| A0A0E0M6J7 | 16-206 | None |
| Q2QX85 | 2-144 | None |
| A0A843UU46 | 224-405 | None |
| A0A671E9U1 | 6-106 | None |
| A0A287HFA5 | 2-154 | None |
| I3SER0 | 2-134 | None |
| J3LPW9 | 12-200 | None |
| A0A0G4HQB0 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.