DPCstruct | MC48707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4A5Z1 | 834-939 | IEDQYLQTWHSNLENSSKLRFYKNYKSSFEFESYLDANIGDKFKFLICKFRVGNLKLHIEIGRFNKTIREKRYCLCCKSKYIEDEFH… |
| A0A6J7ZY66 | 82-192 | GVGDTKLFMNLFKQRLKDINLQTWSDYIGNSSKCAFYSKVKDYVCINENIQKLSYNLRYEFLSIICSNHKLALKKGRHENQPRENRL… |
| A0A8B6BP09 | 4-115 | None |
| A0A6J8B829 | 92-203 | None |
| A0A6J8ATP1 | 45-145 | None |
| R7UX17 | 70-187 | None |
| A0A6J8D0S3 | 127-223 | None |
| A0A0E9XH21 | 1-122 | None |
| A0A6J8D2I3 | 501-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.