DPCstruct | MC48696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 621 |
|---|---|
| Mean domain length (aa) | 210 ± 51 aa |
| Standard deviation of domain lengths | 50.60 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 68.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.49 |
| Pfam Score | 96.24 |
| Assigned Pfam label(s) | CL0023- PF13868- CL0489- PF02944- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182G3P2 | 9-212 | KCVWSKDAVMALITSWSSKEHLYNTKHDLYKNKHARQHALSEICESLQAIMPGINIDDVKNKINNLRSQYSRELTKHRTSARSGTGT… |
| X1XLZ2 | 178-295 | IDDNKTFWLEFIGLYHTFPELWKVKSEAYKNRIKKDAAYEKLVEKMKEIDPKANRDLVRAKINSLHTSYRRELKKVKSSQKSGAGAD… |
| A0A6L5CS24 | 17-254 | None |
| A0A5E4PNY5 | 1-214 | None |
| A0A5E4Q6X1 | 15-178 | None |
| A0A482X2J3 | 7-290 | None |
| A0A368FEZ3 | 11-254 | None |
| H2B0S6 | 74-371 | None |
| A0A1A9VWB9 | 186-363 | None |
| A0A7E5WXL0 | 268-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.