DPCstruct | MC48694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1Q283 | 3-103 | TDRERLKKDIEIELENLQRLVQEMEELIRELPENPGSVETRAAGSILHDFYCGIEKIFERIAITVDNNLPGGEDWHKQLQKQMATPY… |
| A0A6N7IPE6 | 8-110 | AYLGLIGDLEDKMPSIENIAGKIHSLGQEINRISGKIPEEKLMALAGYLHHFYTGIEDILARIIKTVDGYMPRSGDWHSELLYISSR… |
| A0A1J4ZAG3 | 8-127 | None |
| A0A7C3N5H6 | 383-478 | None |
| A0A1W9TIL8 | 1-119 | None |
| A0A847HMC5 | 1-88 | None |
| A0A6I5ZS92 | 5-111 | None |
| A0A1J4SCB4 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.